PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000505247
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 453aa    MW: 50522.4 Da    PI: 8.4497
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000505247genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.71.8e-31208265259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +d ++ ++tYeg+Hnh+
  MDP0000505247 208 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCIVKKRVERSFQDSSTXITTYEGQHNHQ 265
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-32192267IPR003657WRKY domain
SuperFamilySSF1182904.58E-28200267IPR003657WRKY domain
PROSITE profilePS5081131.433202267IPR003657WRKY domain
SMARTSM007745.5E-36207266IPR003657WRKY domain
PfamPF031063.9E-24208265IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MSNEKKNPYQ YDPFDYNHHE INKSSFPFFN YGTSSIYQNP PHDPQTLNGF GSDHPNSFMS  60
FTDCLHGSLD YNTLSKAFDM SCSSSEVISX PLDHDNNSNK QXAAAXGVGD HSVGTNSTTE  120
NPSTPNYSSI SSSPNEAAGA GAVAVAVDHQ VLDEDSDHKS KKDKQPKLRS DGDDEDKSKK  180
GSKAKKKEKR KREPRXAFLT KSEVDHLEDG YRWRKYGQKA VKNSPYPRSY YRCTTQKCIV  240
KKRVERSFQD SSTXITTYEG QHNHQCPATL RGNLNLNAVG MLSPNSLLAS ASLSGSARFS  300
HEFLAQFLPM DNQLQLQSHQ HDHPPSSTLY STLMSPHRHH HNQQQQQLPA SDYDLLRWAE  360
KQYGFQGIAF SEYXPISARS LTQLAPRXLT PSAXNRVGPT VRAADSHHHE PNGSFVHWMA  420
DIFGLLVDPT GVDRGLMGRV GRGQRVDGKX RS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-262002681078Probable WRKY transcription factor 4
2lex_A3e-262002681078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348356.10.0PREDICTED: probable WRKY transcription factor 71
RefseqXP_008348357.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM5XJ161e-147M5XJ16_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s22480.13e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.14e-43WRKY DNA-binding protein 71